Pay in 4 interest-free payments of $53.12 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
LICTGEMETSQFPGEEKPQASPEGRPESETSC
TNFSF8 Polyclonal Antibody
which represses transcription
Background: Interleukin-9 (IL-9) functions to support the growth of helper T cells
Apaf-1 Polyclonal Antibody-BS90065 Magnetic Separation Rack LICTGEMETSQFPGEEKPQASPEGRPESETSCApaf 1 Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS90065 50, BS90065 100 Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: O14727(Human) O88879(Mouse) Host: Rabbit Reactivity: Human, Mouse Applications: WB, ICC IF, IHC All Applications: WB: 1: 1,000 ICC: 1: 50 1: 200 IHC: 1: 50 1: 200 Background: The mammalian homologs of the Ced 4 proteins, Apaf 1 (Ced 4), Nod1 (CARD4), and Nod2 contain a
US$ 41.28
US$ 34.60
US$ 32.10